SERBP1 Antibody

  • Contact Vendor

Target Serbp1
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym CGI-55, CHD3IP, chromodomain helicase DNA binding protein 3 interacting protein, DKFZP564M2423, HABP4L, PAI-1 mRNA binding protein, PAI1 RNA-binding protein 1, PAI-RBP1DKFZp564M2423, PAIRBP1FLJ90489, plasminogen activator inhibitor 1 RNA binding protein, plasminogen activator inhibitor 1 RNA-binding protein, SERPINE1 mRNA binding protein 1, SERPINE1 mRNA-binding protein 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases CHD3IP, DKFZp564M2423, FLJ90489, HABP4L, PAI-RBP1, PAIRBP1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to SERBP1(SERPINE1 mRNA binding protein 1) The peptide sequence was selected from the middle region of SERBP1. Peptide sequence SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE