Jarid1A Antibody

  • Contact Vendor

Target KDM5A
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym EC 1.14.11, EC 1.14.11.-, Histone demethylase JARID1A, JARID1AJumonji, AT rich interactive domain 1A (RBP2-like), Jumonji, AT rich interactive domain 1A (RBBP2-like), Jumonji/ARID domain-containing protein 1A, lysine (K)-specific demethylase 5A, RBP2retinoblastoma binding protein 2, RBBP-2, RBBP2lysine-specific demethylase 5A, Retinoblastoma-binding protein 2jumonji, AT rich interactive domain 1A
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases JARID1A, RBBP-2, RBBP2, RBP2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQLLLSKKQKHRQSPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERAQEAMMDETPDSSK