Rabbit Anti-Human E2F1 Polyclonal, Unconjugated

  • Rabbit Anti-Human E2F1 Polyclonal, Unconjugated

    CatalogueID : NB300-701

  • Contact Vendor

Unit 0.1 mg
Description Synthetic peptide: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD, corresponding to amino acids 58-93 of Human E2F1.
Cite This Product Novus Biologicals cat# NB300-701 RRID:AB_10002343