RBP4 Antibody

  • Contact Vendor

Target RBP4
Species Cross Reactivity Mus musculus, Rattus norvegicus
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target/Molecule Synonym interstitial, Plasma retinol-binding protein, retinol binding protein 4, plasma, retinol-binding protein 4, plasma
Unit 50 ug
Format Peptide affinity purified
Concentration LYOPH mg/ml
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to RBP4(retinol binding protein 4, plasma) The peptide sequence was selected from the N terminal of RBP4. Peptide sequence MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP.
Gene Name retinol binding protein 4, plasma
Uniprot ID P06912