CRABP1 Antibody

  • Contact Vendor

Target crabp1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym cellular retinoic acid binding protein 1, CRABP, CRABPI, CRABP-Icellular retinoic acid-binding protein 1, RBP5Cellular retinoic acid-binding protein I
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CRABP, CRABP-I, CRABPI, RBP5
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE