DCTN-50 Antibody

  • Contact Vendor

Target dctn2
Species Cross Reactivity Mus musculus
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target/Molecule Synonym DCTN-50, DCTN5050 kD dynein-associated polypeptide, dynactin 2 (p50), dynactin complex 50 kD subunit, Dynactin complex 50 kDa subunit, dynactin subunit 2,50 kDa dynein-associated polypeptide, DYNAMITIN, p50 dynamitin, RBP50
Unit 50 ug
Format Peptide affinity purified
Concentration LYOPH mg/ml
NCBI Gene Aliases DCTN50,DYNAMITIN,RBP5
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to DCTN-50 (dynactin 2 (p50)) The peptide sequence was selected from the N terminal of DCTN-50 . Peptide sequence ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI.
Gene Name dynactin 2 (p50)