DCTN-50 Antibody

  • Contact Vendor

Target dctn2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym DCTN5050 kD dynein-associated polypeptide, DCTN-50, dynactin complex 50 kD subunit, Dynactin complex 50 kDa subunit, dynactin subunit 2,50 kDa dynein-associated polypeptide, DYNAMITIN, dynactin 2 (p50), p50 dynamitin, RBP50
Unit 0.1 ml
Format Immunogen affinity purified
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL