RBPMS2 Antibody

  • Contact Vendor

Target Rbpms2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym RNA binding protein with multiple splicing 2, RNA-binding protein with multiple splicing 2
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RBPMS2(RNA binding protein with multiple splicing 2) The peptide sequence was selected from the middle region of RBPMS2. Peptide sequence MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW