STXBP1 Antibody

  • Contact Vendor

Target STXBP1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC-P, WB
Target Species Homo sapiens
Target/Molecule Synonym EIEE4, FLJ37475, hUNC18, MUNC18-1, NSEC1, N-Sec1, P67, p67, Protein unc-18 homolog 1, Protein unc-18 homolog A, RBSEC1, rbSec1, syntaxin binding protein 1, syntaxin-binding protein 1, unc18-1, Unc18-1, UNC18A, unc-18A, Unc-18A, UNC18neuronal SEC1
Unit 100 ul
Format Affinity purified
NCBI Gene Aliases FLJ37475,MUNC18-1,NSEC1,P67,RBSEC1,UNC1
Company Novus Biologicals
Isotype IgG
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: TDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPT
Gene Name syntaxin binding protein 1