RBKS Antibody

  • Contact Vendor

Target RBKS
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 2.7.1.15, RBSKDKFZp686G13268,5230400M11Rik, ribokinase
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp686G13268, RBSK
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LNTEDLRAAANVISRAKVMVCQLEITPATSLEALTMARRSGVKTLFNPAPAIADLDPQFYTLSDVFCCNESEAEILTGLTVGSAADAGEAALVLLK