PCBP3 Antibody

  • Contact Vendor

Target Pcbp3
Species Cross Reactivity Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym Alpha-CP3, poly (rC)-binding protein 310ALPHA-CP3, poly(rC) binding protein 3, poly(rC)-binding protein 3
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases ALPHA-CP3
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to PCBP3(poly(rC) binding protein 3) The peptide sequence was selected from the middle region of PCBP3. Peptide sequence QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI