PCBP1 Antibody

  • Contact Vendor

Target PCBP1
Species Cross Reactivity Canis lupus familiaris, Oryctolagus cuniculus, Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym alpha-CP1, Alpha-CP1, heterogenous nuclear ribonucleoprotein E1, heterogenous nuclear ribonucleoprotein X, Heterogeneous nuclear ribonucleoprotein E1, HNRPE1, HNRPX, hnRNP E1, hnRNP-E1, hnRNP-X, nucleic acid binding protein sub 2.3, Nucleic acid-binding protein SUB2.3, poly(rC) binding protein 1, poly(rC)-binding protein 1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases HNRPE1, HNRPX, hnRNP-E1, hnRNP-X
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of human PCBP1. Peptide sequence PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF