PCBP2 Antibody

  • Contact Vendor

Target PCBP2
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Alpha-CP2, alpha-CP2, heterogenous nuclear ribonucleoprotein E2, Heterogeneous nuclear ribonucleoprotein E2, HNRPE2, hnRNP E2, hnRNP-E2, MGC110998, poly(rC) binding protein 2, poly(rC)-binding protein 2
Unit 0.1 mg
Format Protein A purified
Concentration LYOPH
NCBI Gene Aliases HNRPE2, MGC110998, hnRNP-E2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to PCBP2 (poly(rC) binding protein 2) The peptide sequence was selected from the middle region of PCBP2 (NP_005007). Peptide sequence VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ