TUG Antibody

  • Contact Vendor

Target Aspscr1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Alveolar soft part sarcoma chromosomal region candidate gene 1 protein, alveolar soft part sarcoma chromosome region, candidate 1, Alveolar soft part sarcoma locus, ASPLUBX domain-containing protein 9, ASPSrenal cell carcinoma gene on chromosome 17, Renal papillary cell carcinoma protein 17, RCC17renal cell carcinoma, papillary, 17, tether containing UBX domain for GLUT4, TUG, UBXN9FLJ45380, UBX domain protein 9, UBXD9ASPCR1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases ASPCR1, ASPL, ASPS, FLJ45380, RCC17, TUG, UBXD9, UBXN9
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS