Transcription factor E3 Antibody

  • Contact Vendor

Target TFE3
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym BHLHE33, bHLHe33transcription factor E3, Class E basic helix-loop-helix protein 33, RCCP2, TFEA, transcription factor binding to IGHM enhancer 3, transcription factor E family, member A, Transcription factor for IgH enhancer
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 0.2 mg/ml
NCBI Gene Aliases RCCP2, TFEA, bHLHe33
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS