RQCD1 Antibody

  • Contact Vendor

Target RQCD1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym cancer/testis antigen 129, CNOT9protein involved in sexual development, CT129, rcd-1, Rcd-1, rcd1 (required for cell differentiation, S.pombe) homolog 1, RCD1 required for cell differentiation1 homolog (S. pombe), RCD1+, RCD1cell differentiation protein RCD1 homolog
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CNOT9, CT129, RCD1, RCD1+
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:WHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTS