RCE1 Antibody

  • Contact Vendor

Target Rce1
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym CAAX prenyl protease 2, EC 3.4.22.-, FACE-2, FACE2RCE1 homolog, prenyl protein protease (S. cerevisiae), farnesylated protein-converting enzyme 2, Farnesylated proteins-converting enzyme 2, hRCE1, Prenyl protein-specific endoprotease 2, RCE1 (S. Cerevisiae) homolog, prenyl protein protease, RCE1 homolog, RCE1 homolog, prenyl protein peptidase (S. cerevisiae), RCE1 homolog, prenyl protein protease, RCE1A, RCE1B
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases FACE2, RCE1A, RCE1B
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RCE1(RCE1 homolog, prenyl protein peptidase (S. cerevisiae)) The peptide sequence was selected from the N terminal of RCE1. Peptide sequence WARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFF