KPNA2 Antibody

  • Contact Vendor

Target Kpna2
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym importin-alpha-P1, importin alpha 1, IPOA1, karyopherin alpha 2 (RAG cohort 1, importin alpha 1), Karyopherin subunit alpha-2, pendulin, QIP2importin alpha 2, RAG cohort 1, RAG cohort protein 1, RCH1importin subunit alpha-2, SRP1, SRP1alpha, SRP1-alpha
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases IPOA1, QIP2, RCH1, SRP1alpha
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to KPNA2(karyopherin alpha 2 (RAG cohort 1, importin alpha 1)) The peptide sequence was selected from the middle region of KPNA2. Peptide sequence GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ