DDX6 Antibody

  • Contact Vendor

Target DDX6
Species Cross Reactivity Mus musculus, Rattus norvegicus
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target/Molecule Synonym ATP-dependent RNA helicase p54, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD), DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, DEAD box protein 6, EC 3.6.4.13, EC 3.6.1, FLJ36338, HLR2DEAD box-6, Oncogene RCK, probable ATP-dependent RNA helicase DDX6, RCKP54
Unit 100 ug
Format IgG purified
Concentration LYOPH mg/ml
NCBI Gene Aliases FLJ36338,HLR2,P54,RC
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to DDX6 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 6) The peptide sequence was selected from the N terminal of DDX6 . Peptide sequence KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ.
Gene Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 6