DDX6 Antibody

  • Contact Vendor

Target DDX6
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym ATP-dependent RNA helicase p54, DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD), DEAD box protein 6, EC 3.6.4.13, EC 3.6.1, FLJ36338, HLR2DEAD box-6, Oncogene RCK, probable ATP-dependent RNA helicase DDX6, RCKP54
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ36338, HLR2, P54, RCK
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ