DDX6 Antibody

  • Contact Vendor

Target DDX6
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym ATP-dependent RNA helicase p54, DEAD (Asp-Glu-Ala-Asp) box polypeptide 6, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54kD), DEAD box protein 6, EC 3.6.4.13, EC 3.6.1, FLJ36338, HLR2DEAD box-6, Oncogene RCK, probable ATP-dependent RNA helicase DDX6, RCKP54
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 0.05 mg/ml
NCBI Gene Aliases FLJ36338, HLR2, P54, RCK
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQD