YSK4 Antibody

  • Contact Vendor

Target Map3k19
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 2.7.11, EC 2.7.11.1, FLJ23074, regulated in COPD kinase, Regulated in COPD, protein kinase, RCK, SPS1/STE20-related protein kinase YSK4, YSK4 Sps1/Ste20-related kinase homolog (S. cerevisiae), yeast Sps1/Ste20-related kinase 4, yeast Sps1/Ste20-related kinase 4 (S. cerevisiae)
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ23074, RCK
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FVPGGSISSIINRFGPLPEMVFCKYTKQILQGVAYLHENCVVHRDIKGNNVMLMPTGIIKLIDFGCARRLAWAGLNGTHSDMLKSMHGTPYWMAPEVINESGYGR