RAB11FIP1 Antibody

  • Contact Vendor

Target Rab11fip1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym DKFZp686E2214, EC 6.1.1.7, EC 3.2.1.28, FLJ22524, FLJ22622, MGC78448, NOEL1A, rab11 family-interacting protein 1, Rab11-FIP1, rab11-FIP1, RAB11 coupling protein, RAB11 family interacting protein 1 (class I), Rab-coupling protein, Rab-interacting recycling protein, RCPRab effector protein
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp686E2214, FLJ22524, FLJ22622, MGC78448, NOEL1A, RCP, rab11-FIP1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TGSAKHRLHPVKPMNAMATKVANCSLGTATIISENLNNEVMMKKYSPSDPAFAYAQLTHDELIQLVLKQKETISKKEFQVR