PEX7 Antibody

  • Contact Vendor

Target pex7
Species Cross Reactivity Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym peroxin-7, Peroxin-7, peroxisome targeting signal 2 receptor, peroxisomal targeting signal 2 receptor, peroxisomal biogenesis factor 7, PTS2 receptor, PTS2Rperoxisomal PTS2 receptor, RCDP1, RD
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases PTS2R, RCDP1, RD
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to PEX7(peroxisomal biogenesis factor 7) The peptide sequence was selected from the N terminal of PEX7. Peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI