PHYH Antibody

  • Contact Vendor

Target PhyH
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym LNAP1, PAHXLN1, peroxisomal, phytanoyl-CoA hydroxylase, phytanoyl-CoA hydroxylase (Refsum disease), PhyH, PHYH1, phytanoyl-CoA 2-hydroxylase, RD
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases LN1, LNAP1, PAHX, PHYH1, RD
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRA