NELF-E Antibody

  • Contact Vendor

Target NELFE
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym D6S45, negative elongation factor E, negative elongation factor polypeptide E, NELFE, NELF-ERDmajor histocompatibility complex gene RD, nuclear protein, RDP, RD RNA binding protein, RD RNA-binding protein, RNA-binding protein RD
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases D6S45, NELF-E, RD, RDP
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RDBP(RD RNA binding protein) The peptide sequence was selected from the N terminal of RDBP. Peptide sequence LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS