TXNL6 Antibody

  • Contact Vendor

Target nxnl1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym nucleoredoxin-like 1, nucleoredoxin-like protein 1, RDCVF, rod-derived cone viability factor, thioredoxin-like 6, Thioredoxin-like protein 6, TXNL6
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RDCVF, TXNL6
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVE