PITPNM2 Antibody

  • Contact Vendor

Target Pitpnm2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym phosphatidylinositol transfer protein, membrane-associated 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA1457, NIR3, RDGB2, RDGBA2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PKDITKWSSNDLMDKIESPEPEDTQDGLYRQGAPEFRVASSVEQLNIIEDEVSQPLAAPPSKIHVLLLVLHGGTILDTGAGDPSSKKGDANTIANVFDTVMRVHYPSALGRLAIRLVPCPPVCSDAFALVSN