RDH10 Antibody

  • Contact Vendor

Target rdh10
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 1.1.1.n2, EC 1.1.1.300, EC 1.1.1, retinol dehydrogenase 10, retinol dehydrogenase 10 (all-trans), SDR16C4, short chain dehydrogenase/reductase family 16C, member 4
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases SDR16C4
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RDH10(retinol dehydrogenase 10 (all-trans)) The peptide sequence was selected from the N terminal of RDH10. Peptide sequence QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG