RDH12 Antibody

  • Contact Vendor

Target RDH12
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym All-trans and 9-cis retinol dehydrogenase, EC 1.1.1.100, EC 1.1.1, EC 1.1.1.-, FLJ30273, LCA13retinol dehydrogenase 12, all-trans and 9-cis, LCA3, retinol dehydrogenase 12, retinol dehydrogenase 12 (all-trans and 9-cis), retinol dehydrogenase 12 (all-trans/9-cis/11-cis), SDR7C2, short chain dehydrogenase/reductase family 7C, member 2
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ30273, LCA13, LCA3, SDR7C2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RDH12(retinol dehydrogenase 12 (all-trans/9-cis/11-cis)) The peptide sequence was selected from the middle region of RDH12. Peptide sequence HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV