RDH13 Antibody

  • Contact Vendor

Target RDH13
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym DKFZp313H0740, EC 1.1.1.-, FLJ39479, retinol dehydrogenase 13, retinol dehydrogenase 13 (all-trans and 9-cis), retinol dehydrogenase 13 (all-trans/9-cis), SDR7C3, short chain dehydrogenase/reductase family 7C, member 3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp313H0740, FLJ39479, SDR7C3
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPELAAQPSTYLAVAEELADVSGKYFDGL