RAD54B Antibody

  • Contact Vendor

Target Rad54b
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DNA repair and recombination protein RAD54B, EC 3.6.4.-, EC 3.6.1, fibrinogen silencer binding protein, FSBP, RAD54 homolog B, RAD54 homolog B (S. cerevisiae), RDH54
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FSBP, RDH54
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RAD54B(RAD54 homolog B (S. cerevisiae)) The peptide sequence was selected from the N terminal of RAD54B. Peptide sequence RRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINN