RAD54B Antibody

  • Contact Vendor

Target Rad54b
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym DNA repair and recombination protein RAD54B, EC 3.6.4.-, EC 3.6.1, fibrinogen silencer binding protein, FSBP, RAD54 homolog B, RAD54 homolog B (S. cerevisiae), RDH54
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FSBP, RDH54
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KEQEEKSDSLVKYFSVVWCKPSKKKHKKWEGDAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEVMGVISPDDFSSGRCFQLGGGSTAISHSSQVARKCFSNP