SDR16C5 Antibody

  • Contact Vendor

Target SDR16C5
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 1.1.1.105, EPHD-2, epidermal retinol dehydrogenase 2, FLJ33105, retinal short chain dehydrogenase reductase, Retinal short-chain dehydrogenase reductase 2, RDH-E2epidermal retinal dehydrogenase 2, RDHE2RDH#2, retSDR2, Short-chain dehydrogenase/reductase family 16C member 5, short chain dehydrogenase/reductase family 16C, member 5
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ33105, RDH#2, RDH-E2, RDHE2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFVDQKKKL