SDR16C5 Antibody

  • Contact Vendor

Target SDR16C5
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym EC 1.1.1.105, EPHD-2, epidermal retinol dehydrogenase 2, FLJ33105, retinal short chain dehydrogenase reductase, Retinal short-chain dehydrogenase reductase 2, RDH-E2epidermal retinal dehydrogenase 2, RDHE2RDH#2, retSDR2, Short-chain dehydrogenase/reductase family 16C member 5, short chain dehydrogenase/reductase family 16C, member 5
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ33105, RDH#2, RDH-E2, RDHE2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RDHE2(epidermal retinal dehydrogenase 2) The peptide sequence was selected from the middle region of RDHE2. Peptide sequence AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT