SDR9C7 Antibody

  • Contact Vendor

Target SDR9C7
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target/Molecule Synonym EC 1.1.1, EC 1.1.1.-, FLJ16333, MGC126600, Orphan short-chain dehydrogenase/reductase, RDH-S, RDHSMGC126602, SDR-Oorphan short-chain dehydrogenase / reductase, SDROretinol dehydrogenase similar protein, short-chain dehydrogenase/reductase family 9C member 7, short chain dehydrogenase/reductase family 9C, member 7
Unit 50 ug
Format Peptide affinity purified
Concentration LYOPH mg/ml
NCBI Gene Aliases FLJ16333,MGC126600,MGC126602,RDHS,SDR-O,SDR
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to SDR-O(orphan short-chain dehydrogenase / reductase) The peptide sequence was selected from the middle region of SDR-O. Peptide sequence SMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADS.
Gene Name short chain dehydrogenase/reductase family 9C, member 7