SDR9C7 Antibody

  • Contact Vendor

Target SDR9C7
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym EC 1.1.1, EC 1.1.1.-, FLJ16333, MGC126600, Orphan short-chain dehydrogenase/reductase, RDH-S, RDHSMGC126602, SDR-Oorphan short-chain dehydrogenase / reductase, SDROretinol dehydrogenase similar protein, short chain dehydrogenase/reductase family 9C, member 7, short-chain dehydrogenase/reductase family 9C member 7
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ16333, MGC126600, MGC126602, RDHS, SDR-O, SDRO
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EPRVRDVINSMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADS