LEO1 Antibody

  • Contact Vendor

Target Leo1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae), RDLReplicative senescence down-regulated leo1-like protein, RNA polymerase-associated protein LEO1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RDL
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DEERAQGSDEDKLQNSDDDEKMQNTGDEERPQLSDDERQQLSEEEKANSDDERPVASDNDDEKQNSDDEGQPQLSDEEKMQNSDDER