RDM1 Antibody

  • Contact Vendor

Target RDM1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym MGC33977, RAD52 homolog B, RAD52 homolog B (S. cerevisiae), RAD52 motif 1, RAD52 motif-containing protein 1, RAD52B
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC33977, RAD52B
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RDM1(RAD52 motif 1) The peptide sequence was selected from the middle region of RDM1. Peptide sequence NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF