SLC1A5 Antibody

  • Contact Vendor

Target Slc1a5
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym AAAT, ASCT2M7VS1, ATB(0), Baboon M7 virus receptor, M7V1ATBO, neutral amino acid transporter B, neutral amino acid transporter B(0), R16, RDR, RDRCFLJ31068, RD114 virus receptor, RD114/simian type D retrovirus receptor, solute carrier family 1 (neutral amino acid transporter), member 5, Sodium-dependent neutral amino acid transporter type 2, Solute carrier family 1 member 5
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases AAAT, ASCT2, ATBO, FLJ31068, M7V1, M7VS1, R16, RDRC
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN