PRPH2 Antibody

  • Contact Vendor

Target prph2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym AOFMD, AVMD, CACD2peripherin 2, homolog of mouse, DS, peripherin 2 (retinal degeneration, slow), peripherin-2, PRPHperipherin, photoreceptor type, RDS, Retinal degeneration slow protein, retinal degeneration, slow, retinal peripherin, rd2, RP7, tetraspanin-22, Tetraspanin-22, tspan-22, Tspan-22, TSPAN22retinal degeneration, slow (retinitis pigmentosa 7)
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases AOFMD, AVMD, CACD2, DS, PRPH, RDS, RP7, TSPAN22, rd2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GSLENTLGQGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQITNNSAHYSYDHQTEELNLWVR