SNF5 Antibody

  • Contact Vendor

Target SMARCB1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym BAF47hSNF5, BRG1-associated factor 47, hSNFS, Ini1, INI1RTPS1, Integrase interactor 1 protein, malignant rhabdoid tumor suppressor, RDTSNF5 homolog, Sfh1p, SNF5, SNF5L1, Snr1, sucrose nonfermenting, yeast, homolog-like 1, subfamily b, member 1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases BAF47, INI1, RDT, RTPS1, SNF5, SNF5L1, Sfh1p, Snr1, hSNFS
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:EKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTA