SNF5 Antibody

  • Contact Vendor

Target SMARCB1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym BAF47hSNF5, BRG1-associated factor 47, hSNFS, Ini1, INI1RTPS1, Integrase interactor 1 protein, malignant rhabdoid tumor suppressor, RDTSNF5 homolog, Sfh1p, SNF5, SNF5L1, Snr1, sucrose nonfermenting, yeast, homolog-like 1, subfamily b, member 1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily B member 1
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 0.1 mg/ml
NCBI Gene Aliases BAF47, INI1, RDT, RTPS1, SNF5, SNF5L1, Sfh1p, Snr1, hSNFS
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPE