WDR61 Antibody

  • Contact Vendor

Target Wdr61
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym Meiotic recombination REC14 protein homolog, REC14, recombination protein REC14, SKI8, WD repeat-containing protein 61, WD repeat domain 61
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases REC14, SKI8
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTR