REC8 Antibody

  • Contact Vendor

Target REC8
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Cohesin Rec8p, cohesion rec8p, HR21spB, meiotic recombination and sister chromatid cohesion phosphoprotein of therad21p family, meiotic recombination protein REC8 homolog, meiotic recombination protein REC8-like 1, MGC950, REC8 homolog (yeast), REC8L1human homolog of rad21, S. pombe, REC8-like 1, REC8-like 1 (yeast), Rec8p, recombination and sister chromatid cohesion protein homolog
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 1.1 mg/ml
NCBI Gene Aliases HR21spB, MGC950, REC8L1, Rec8p
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PSVPLMVSLEISLEAAEEEKSRISLIPPEERWAWPEVEAPEAPALPVVPELPEVPMEMPLVLPPELELLSLEAVHRAVALELQANREPDFSSLVSPLSP