RTP2 Antibody

  • Contact Vendor

Target RTP2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym receptor (chemosensory) transporter protein 2, receptor transporter protein 2, receptor transporting protein 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC78665
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YRIHVASRPDSGPHRAEFCEACQEGIVHWKPSEKLLEEEVTTYTSEASKPRAQAGSGYNF