RTP3 Antibody

  • Contact Vendor

Target RTP3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym LTM1, receptor (chemosensory) transporter protein 3, receptor transporter protein 3, TMEM7receptor-transporting protein 3, Transmembrane protein 7receptor transporting protein 3
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases LTM1, TMEM7
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QVLVLFHMNWSEEKSRGQVKMRVFTQRCKKCPQPLFEDPEFTQENISRILKNLVFRILKKCYRGRFQLIEEVPMIKDISLEGPHNSDNCEACLQGFCAGPIQVTSLPPSQTPRVHSIYKVEEVVKPWA