MRAP Antibody

  • Contact Vendor

Target Mrap
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym B27GCCD2, C21orf61chromosome 21 open reading frame 61, FALPFGD2, Fat cell-specific low molecular weight protein, Fat tissue-specific low MW protein, melanocortin 2 receptor accessory protein, melanocortin-2 receptor accessory protein
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases B27, C21orf61, FALP, FGD2, GCCD2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS