IL1RAPL2 Antibody

  • Contact Vendor

Target Il1rapl2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym IL-1R-9, IL1R9IL-1 receptor accessory protein-like 2, IL-1R9IL-1RAPL-2, IL-1-RAPL-2, IL1RAPL-2IL1RAPL-2-related protein, interleukin 1 receptor 9, interleukin 1 receptor accessory protein-like 2, TIGIRR-1Interleukin-1 receptor 9, Three immunoglobulin domain-containing IL-1 receptor-related 1, X-linked interleukin-1 receptor accessory protein-like 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases IL-1R9, IL1R9, IL1RAPL-2, TIGIRR-1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TTELKVTALLTDKPPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLL