ROR2 Antibody

  • Contact Vendor

Target Ror2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym BDB, BDB1, EC 2.7.10.1, MGC163394, neurotrophic tyrosine kinase receptor-related 2, Neurotrophic tyrosine kinase, receptor-related 2, NTRKR2tyrosine-protein kinase transmembrane receptor ROR2, receptor tyrosine kinase-like orphan receptor 2
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases BDB, BDB1, MGC163394, NTRKR2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQEAEEEEEGSVPETELLG